[ICLR 2024] Mol-Instructions: A Large-Scale Biomolecular Instruction Dataset for Large Language Models
Python
294
210 commits
updated Oct 28, 2024


Mol-Instructions comprises three cardinal components:

We release the dataset on Hugging Face at zjunlp/Mol-Instructions.
Please give me some details about this molecule: [C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][=Branch1][C][=O][O][C@H1][Branch2][Ring1][=Branch1][C][O][C][=Branch1][C][=O][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][O][P][=Branch1][C][=O][Branch1][C][O][O][C][C@@H1][Branch1][=Branch1][C][=Branch1][C][=O][O][N]
The molecule is a 3-sn-phosphatidyl-L-serine in which the phosphatidyl acyl groups at positions 1 and 2 are specified as stearoyl and arachidonoyl respectively.
It is functionally related to an arachidonic acid and an octadecanoic acid.
Create a molecule with the structure as the one described: The molecule is a primary arylamine in which an amino functional group is substituted for one of the benzene hydrogens. It is a primary arylamine and a member of anilines.
[N][C][=C][C][=C][C][=C][Ring1][=Branch1]
With the provided reactants and reagents, propose a potential product: [O][=N+1][Branch1][C][O-1][C][=C][N][=C][Branch1][C][Cl][C][Branch1][C][I][=C][Ring1][Branch2].[Fe]
[N][C][=C][N][=C][Branch1][C][Cl][C][Branch1][C][I][=C][Ring1][Branch2]
Please suggest potential reactants used in the synthesis of the provided product: [C][=C][C][C][N][C][=Branch1][C][=O][O][C][Branch1][C][C][Branch1][C][C][C]
[C][=C][C][C][N].[C][C][Branch1][C][C][Branch1][C][C][O][C][=Branch1][C][=O][O][C][=Branch1][C][=O][O][C][Branch1][C][C][Branch1][C][C][C]
Please provide possible reagents based on the following chemical reaction: [C][C][=C][C][=C][Branch1][C][N][C][=N][Ring1][#Branch1].[O][=C][Branch1][C][Cl][C][Cl]>>[C][C][=C][C][=C][Branch1][Branch2][N][C][=Branch1][C][=O][C][Cl][C][=N][Ring1][O]
[C][C][C][O][C][Ring1][Branch1].[C][C][N][Branch1][Ring1][C][C][C][C].[O]
Please provide the HOMO energy value for this molecule: [C][C][O][C][C][Branch1][C][C][C][Branch1][C][C][C]
-0.2482
MSNELVLSREQVRRVDQRAIEAYGVPGIVLMENAGRGAAEIIRAACPSAQRVLIACGPGNNGGDGFVIARHLANAGWMVELLLACPADRITGDAQGNHEIIRRMNLPCAVMADARDLEAANDRFATADVIVDALLGTGASGPPREPIASLIRAINEAHRRVSAQPAPSVFAVDIPSGLDCDTGEAANPTVRADHTITFVARKIGFRNPAARDLLGRVHVVDIGAPRAAIQDALTGKSG
Please evaluate the following protein sequence and provide an explanation of the enzyme's catalytic activity, including the chemical reaction it facilitates: MDKVAVAGFLPEELCASLSLSPSFRGNQIFQWIGKGVDSFDAMTNLSAELRASLAEKAILRSTRVSDVLKADDGTVKLQIQTEDDLAVETVLLTDKAARKTACVSCQAGCAMGCAFCKTGTLGLARNLSAAEIVEQFLYLEKHAGALDNIVFMGMGEPLLNLDALRKAIAVLTDKRGRNLSSRRITVSTVGIVSGIYDLANNGPDVRLAVSLTTADETLRRELMPASLTNPLSDLRQAISYYIEKTGKRVTLEAVLLSGKNTSEKNADSLIAFAKGLDVHVNLIPWNPVEGLSFVTPDPEETAQFVSRLEKGGLNVTLRMHRGKSISGACGQLGKTNPYA
Based on the provided protein sequence, the enzyme appears to facilitate the chemical reaction: adenosine(37) in tRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S- adenosyl-L-methionine = 2-methyladenosine(37) in tRNA + 5'- deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S- adenosyl-L-homocysteine.
Analyze the following amino acid sequence, and determine the function of the resulting protein, its subcellular localization, and any biological processes it may be part of: MNGTVNASAPSKMSEVAVERLSNDKALKVIFVLGGPGSGKGTQCAKIAKHFGFTHLSVGDLLRAEINSGSKNGTMIESMINEGKIVRSEVTIKLLQRAMHESGNDKFLIDGFPRNEENRAAFENLEKIEPEFVLFFDCPMEEMERRILNRNQGRDDDKMETIRKRFKVFIESTLPVIEFYNLKGKLYKIDACKPADEVFEDVKAIFSRFRAKEDSSQQTNICTAKRFELVMCLIKRLFREIKRMWSSFFCKAL
The protein characterized by the amino acid sequence demonstrates ATP binding, cytidylate kinase activity, uridylate kinase activity and is implicated in the 'de novo' pyrimidine nucleobase biosynthetic process, phosphorylation, pyrimidine nucleotide biosynthetic process. Its subcellular localization is primarily within the cytoplasm, nucleus.
Examine the given protein sequence and share a brief overview of its attributes: MKIVLASNNQGKLAELKAMLAPLGVQLLRQAELGIPEAAEPFRTFVENALAKARHASALSGLPALADDAGLCVEAFGGLPGVDTAFYAVQFGYAKGDANNVKALLAQMAGITDRRAALVSTLVAVRSAEDPEPLIACGRVAGEVALEPMGSNGFGFDPVMFIPEFGQTFAQLPVEVKNANSHRGKATRQMMALMRERWIT
A concise description of the protein with the specified amino acid sequence includes: Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.
Given this protein sequence, can you identify any common protein motifs or domains that it may contain? MANTKYIFITGGVVSSLGKGIAAASIGALLESRGLSVSLIKVDPYINVDPGTMSPFQHGEVFVTEDGTETDLDLGHYERFVRFKASKKNNFTAGKVYETVIRNERKGNYLGGTVQVIPHITNEIKKRIKKGGQNKDIAIVEVGGTVGDIESQPFVEALRQMALELPNSSWAFVHLTLVPFINASGELKTKPTQHSVKELRSLGISPDVLVCRSEQELPKDEKNKIALFCSVPAKSVISMHDVDTVYSIPILLNKQKVDDTILKKLNLKIKKPNLNDWKRVVKAKLLPEKEVNVSFVGKYTELKDSYKSINEALEHAGIQNKAKVNINFVEAEQITSQNVRKVLKKSDAILVPGGFGERGIEGMILACKYARENNVPYLGICLGMQIAIIEYARNVLKLKSANSTEFDSSTKFPVIGLITEWSDISGKKEKRTKNSDLGGTMRLGGQVCKLKKKSNSYKMYKKSEIIERHRHRYEVNPNYKDKMIEQGLDVVGTSIDGKLVEMIELPSHKWFLACQFHPEFTSNPRDGHPIFNSYIKSTITK
Our predictive analysis of the given protein sequence reveals possible domains or motifs. These include: Glutamine amidotransferase, CTP synthase N-terminal domains.
Find and list all the instances of the chemical entities in the following content: "Both the control and caramiphen groups with double cannulas had significantly shorter latencies to seizure onset than the corresponding groups with single cannula."
caramiphen
You are provided with a set of clinical trial summaries. Extract the chemical-disease relations from the summaries and present your findings in the format of (Subject, Object): "Eating disorders and the associated behavioural problems and drug abuse are uncommon in pregnancy. When they do occur they are often unrecognized because of denial but when significant may pose a risk to both the mother and her fetus. This case illustrates a number of problems that may be encountered in women with eating disorders in pregnancy, including prolonged and recurrent metabolic disturbances and diuretic abuse. In particular it illustrates the derangements of thyroid function seen in pregnant women with eating disorders and reminds us that when a cause for thyrotoxicosis remains obscure, thyroxine abuse should be considered and explored."
(thyroxine, thyrotoxicosis)
Your task is to extract the subject and object entities from the provided text and establish the corresponding relation triples. Please format your answers as (Subject, Relation, Object): "Opioid receptors are the membrane proteins that mediate the pain-relieving effect of opioid drugs, such as morphine and fentanyl as well as endogenous opioid peptides enkephalins and endorphins. Using cDNAs for the mu and the kappa opioid receptors, we mapped the chromosomal locations of their genes in mouse. Multilocus cross analysis located the mu receptor gene Oprm on Chr 10 and the kappa receptor gene Oprk1 on Chr 1. Both genes are near centromere, with no markers more centromeric. These data indicate that the two opioid receptors are different gene products, ruling out the possibility that they may be differential splicing products from the same gene."
(morphine, regulator, Opioid receptors), (fentanyl, regulator, Opioid receptors)
Which of the following conditions does not show multifactorial inheritance? What of the following is the right choice? (A) Pyloric stenosis (B) Schizophrenia (C) Spina bifida (neural tube defects) (D) Marfan syndrome
The final answer is (D).
Does feeding tube insertion and its timing improve survival?
No, neither insertion of PEG tubes nor timing of insertion affect survival.
What virus causes chronic disease?
Hepatitis C virus (HCV).

We release the model weights on Hugging Face at:
We have provided a web version demo based on Gradio. To use it, you first need to download this repository:
>> git clone https://github.com/zjunlp/Mol-Instruction
>> cd demo
Step 1, install Gradio by running:pip install gradio.
Step 2, specify the parameters in the generate.sh file.
>> CUDA_VISIBLE_DEVICES=0 python generate.py \
--CLI False\
--protein False\
--load_8bit \
--base_model $BASE_MODEL_PATH \
--share_gradio True\
--lora_weights $FINETUNED_MODEL_PATH \
For models fine-tuned on molecule-oriented and biomolecular text instructions, please set $FINETUNED_MODEL_PATH to 'zjunlp/llama-molinst-molecule-7b' or 'zjunlp/llama-molinst-biotext-7b'.
For the model fine-tuned on protein-oriented instructions, you need to perform additional steps as described in this folder.
Step 3, run the generate.sh file in the repository:
>> sh generate.sh
We offer two methods: the first one is command-line interaction, and the second one is web-based interaction, which provides greater flexibility.
>> python generate.py
The program will run a web server and output an address. Open the output address in a browser to use it.
>> python generate.py --CLI True
The disadvantage is the inability to dynamically change decoding parameters.
To investigate whether Mol-Instructions can enhance LLM’s understanding of biomolecules, we conduct the following quantitative experiments. For detailed experimental settings and analysis, please refer to our paper. Please refer to the evaluation code to conduct the same experiments.
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.004 | 51.088 | 0.006 | 0.029 | 0.000 | 0.002 |
| Baize | 0.000 | 0.006 | 53.796 | 0.000 | 0.000 | 0.000 | 0.002 |
| ChatGLM | 0.000 | 0.004 | 53.157 | 0.005 | 0.000 | 0.000 | 0.005 |
| LLaMa | 0.000 | 0.003 | 59.864 | 0.005 | 0.000 | 0.000 | 0.003 |
| Vicuna | 0.000 | 0.006 | 60.356 | 0.006 | 0.001 | 0.000 | 0.001 |
| Galactica | 0.000 | 0.192 | 44.152 | 0.135 | 0.238 | 0.088 | 0.992 |
| Text+Chem T5 | 0.097 | 0.508 | 41.819 | 0.352 | 0.474 | 0.353 | 0.721 |
| MolT5 | 0.112 | 0.546 | 38.276 | 0.400 | 0.538 | 0.295 | 0.773 |
| Ours (LLaMA2-chat) | 0.002 | 0.345 | 41.367 | 0.231 | 0.412 | 0.147 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.025 | 0.521 | 38.742 | 0.358 | 0.520 | 0.221 | 1.000 |
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.065 | 41.989 | 0.004 | 0.024 | 0.008 | 0.138 |
| Baize | 0.000 | 0.044 | 41.500 | 0.004 | 0.025 | 0.009 | 0.097 |
| ChatGLM | 0.000 | 0.183 | 40.008 | 0.050 | 0.100 | 0.044 | 0.108 |
| LLaMa | 0.000 | 0.020 | 42.002 | 0.001 | 0.002 | 0.001 | 0.039 |
| Vicuna | 0.000 | 0.057 | 41.690 | 0.007 | 0.016 | 0.006 | 0.059 |
| Galactica | 0.000 | 0.468 | 35.021 | 0.156 | 0.257 | 0.097 | 0.946 |
| Text+Chem T5 | 0.239 | 0.782 | 20.413 | 0.705 | 0.789 | 0.652 | 0.762 |
| Ours (LLaMA2-chat) | 0.045 | 0.654 | 27.262 | 0.313 | 0.509 | 0.262 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.503 | 0.883 | 13.410 | 0.756 | 0.863 | 0.708 | 1.000 |
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.063 | 46.915 | 0.005 | 0.023 | 0.007 | 0.160 |
| Baize | 0.000 | 0.095 | 44.714 | 0.025 | 0.050 | 0.023 | 0.112 |
| ChatGLM | 0.000 | 0.117 | 48.365 | 0.056 | 0.075 | 0.043 | 0.046 |
| LLama | 0.000 | 0.036 | 46.844 | 0.018 | 0.029 | 0.017 | 0.010 |
| Vicuna | 0.000 | 0.057 | 46.877 | 0.025 | 0.030 | 0.021 | 0.017 |
| Galactica | 0.000 | 0.452 | 34.940 | 0.167 | 0.274 | 0.134 | 0.984 |
| Text+Chem T5 | 0.141 | 0.765 | 24.043 | 0.685 | 0.765 | 0.585 | 0.698 |
| Ours (LLaMA2-chat) | 0.009 | 0.705 | 31.227 | 0.283 | 0.487 | 0.230 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.333 | 0.842 | 17.642 | 0.704 | 0.815 | 0.646 | 1.000 |
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.026 | 29.037 | 0.029 | 0.016 | 0.001 | 0.186 |
| Baize | 0.000 | 0.051 | 30.628 | 0.022 | 0.018 | 0.004 | 0.099 |
| ChatGLM | 0.000 | 0.019 | 29.169 | 0.017 | 0.006 | 0.002 | 0.074 |
| LLaMa | 0.000 | 0.003 | 28.040 | 0.037 | 0.001 | 0.001 | 0.001 |
| Vicuna | 0.000 | 0.010 | 27.948 | 0.038 | 0.002 | 0.001 | 0.007 |
| Galactica | 0.000 | 0.141 | 30.760 | 0.036 | 0.127 | 0.051 | 0.995 |
| Text+Chem T5 | 0.000 | 0.225 | 49.323 | 0.039 | 0.186 | 0.052 | 0.313 |
| Ours (LLaMA2-chat) | 0.044 | 0.224 | 23.167 | 0.237 | 0.364 | 0.213 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.101 | 0.648 | 18.326 | 0.412 | 0.521 | 0.375 | 1.000 |
| Metric | MAE↓ |
|---|---|
| Alpaca | 322.109 |
| Baize | 261.343 |
| ChatGLM | - |
| LLaMa | 5.553 |
| Vicuna | 860.051 |
| Galactica | 0.568 |
| Ours (LLaMA2-chat) | 0.013 |
| Ours (LLaMA3-Instruct) | 15.059 |
| Metric | BLEU-2↑ | BLEU-4↑ | ROUGE-1↑ | ROUGE-2↑ | ROUGE-L↑ | METEOR↑ |
|---|---|---|---|---|---|---|
| Alpaca | 0.068 | 0.014 | 0.178 | 0.041 | 0.136 | 0.107 |
| Baize | 0.064 | 0.015 | 0.189 | 0.053 | 0.148 | 0.106 |
| ChatGLM | 0.055 | 0.011 | 0.163 | 0.036 | 0.121 | 0.105 |
| LLaMa | 0.059 | 0.014 | 0.164 | 0.066 | 0.148 | 0.184 |
| Vicuna | 0.052 | 0.011 | 0.151 | 0.055 | 0.130 | 0.168 |
| Galactica | 0.024 | 0.008 | 0.074 | 0.015 | 0.063 | 0.065 |
| Text+Chem T5 | 0.062 | 0.036 | 0.126 | 0.075 | 0.119 | 0.139 |
| MolT5 | 0.002 | 0.001 | 0.036 | 0.001 | 0.034 | 0.033 |
| Ours (LLaMA2-chat) | 0.217 | 0.143 | 0.337 | 0.196 | 0.291 | 0.254 |
| Ours (LLaMA3-Instruct) | 0.419 | 0.361 | 0.719 | 0.646 | 0.709 | 0.637 |
| Task | Protein Function | Functional Description | Catalytic Activity | Domain/Motif |
|---|---|---|---|---|
| Metric | ROUGE-L↑ | ROUGE-L↑ | ROUGE-L↑ | ROUGE-L↑ |
| Alpaca | 0.20 | 0.10 | 0.23 | 0.12 |
| Baize | 0.20 | 0.15 | 0.22 | 0.13 |
| ChatGLM | 0.15 | 0.14 | 0.13 | 0.10 |
| LLaMa | 0.12 | 0.12 | 0.13 | 0.09 |
| Vicuna | 0.15 | 0.14 | 0.16 | 0.12 |
| Galactica | 0.07 | 0.08 | 0.08 | 0.06 |
| Ours (LLaMA) | 0.43 | 0.44 | 0.52 | 0.46 |
| Task | True or False | Multi-choice | Chemical Entity Recognition | Chemical-disease Interaction Extraction | Chemical-protein Interaction Extraction |
|---|---|---|---|---|---|
| Metric | Acc↑ | Acc↑ | F1↑ | F1↑ | F1↑ |
| Alpaca | 0.330 | 0.286 | 0.213 | 0.037 | 0.002 |
| Baize | 0.480 | 0.237 | 0.009 | 0.004 | 0.004 |
| ChatGLM | 0.180 | 0.223 | 0.150 | 0.020 | 0.003 |
| LLaMa | 0.270 | 0.297 | 0.000 | 0.050 | 0.003 |
| Vicuna | 0.120 | 0.290 | 0.024 | 0.084 | 0.013 |
| Galactica | 0.420 | 0.312 | 0.166 | 0.026 | 0.001 |
| PMC_LLaMa | 0.510 | 0.625 | 0.003 | 0.000 | 0.000 |
| Ours (LLaMA2-chat) | 0.550 | 0.649 | 0.753 | 0.399 | 0.224 |
| Ours (LLaMA3-instruct) | 0.600 | 0.961 | 0.694 | 0.355 | 0.177 |
| Task | BLEU↑ | ROUGE-1↑ | BertScore↑ |
|---|---|---|---|
| Alpaca | 0.003 | 0.088 | 0.824 |
| Baize | 0.005 | 0.100 | 0.811 |
| ChatGLM | 0.003 | 0.090 | 0.795 |
| LLaMa | 0.003 | 0.100 | 0.814 |
| Vicuna | 0.004 | 0.097 | 0.814 |
| Galactica | 0.000 | 0.039 | 0.794 |
| PMC_LLaMA | 0.007 | 0.788 | 0.625 |
| Ours (LLaMA2-chat) | 0.024 | 0.221 | 0.837 |
| Ours (LLaMA3-instruct) | 0.010 | 0.198 | 0.846 |
Question: What action should be taken if the model encounters <unk> and subsequently repeats the input during decoding?
Answer: Consider reducing the value of the max tokens.
Question: What should I do if the model encounters � during decoding?
Answer: If this symbol emerges in the middle of the decoded sentence, we recommend changing the input. If it shows up at the end of the sentence, you can tackle this issue by extending the output length.
Question: Why do I receive varied results despite using identical decoding parameters?
Answer: This might occur if you have enabled do_sample=True. Another factor could be the order in which tasks are executed. A useful approach would be to use a for loop to generate multiple outputs with the same decoding parameters, enabling you to note the variance in each output.
Question: What could be the reason for subpar answer quality?
Answer: Modifying the decoding parameters could help in improving the quality of the extraction or the answer.
Please note that all data and model weights of Mol-Instructions is exclusively licensed for research purposes. The accompanying dataset is licensed under CC BY 4.0.
We emphatically urge all users to adhere to the highest ethical standards when using our dataset, including maintaining fairness, transparency, and responsibility in their research. Any usage of the dataset that may lead to harm or pose a detriment to society is strictly forbidden.
In terms of dataset maintenance, we pledge our commitment to provide necessary upkeep. This will ensure the continued relevance and usability of the dataset in light of evolving research landscapes. This commitment encompasses regular updates, error checks, and amendments in accordance with field advancements and user feedback.
The current state of the model, obtained via instruction tuning, is a preliminary demonstration. Its capacity to handle real-world, production-grade tasks remains limited. Moreover, there is a vast reservoir of rich instruction data that remains to be collected and exploited.
@inproceedings{fang2023mol,
author = {Yin Fang and
Xiaozhuan Liang and
Ningyu Zhang and
Kangwei Liu and
Rui Huang and
Zhuo Chen and
Xiaohui Fan and
Huajun Chen},
title = {Mol-Instructions: {A} Large-Scale Biomolecular Instruction Dataset
for Large Language Models},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/pdf?id=Tlsdsb6l9n}
}
We appreciate LLaMA, Huggingface Transformers Llama, Alpaca, Alpaca-LoRA, Chatbot Service and many other related works for their open-source contributions. The logo of the model is automatically generated by Wenxin Yige.
Python
100.0%
[ICLR 2024] Mol-Instructions: A Large-Scale Biomolecular Instruction Dataset for Large Language Models
Python
294
210 commits
updated Oct 28, 2024


Mol-Instructions comprises three cardinal components:

We release the dataset on Hugging Face at zjunlp/Mol-Instructions.
Please give me some details about this molecule: [C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][=Branch1][C][=O][O][C@H1][Branch2][Ring1][=Branch1][C][O][C][=Branch1][C][=O][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][C][O][P][=Branch1][C][=O][Branch1][C][O][O][C][C@@H1][Branch1][=Branch1][C][=Branch1][C][=O][O][N]
The molecule is a 3-sn-phosphatidyl-L-serine in which the phosphatidyl acyl groups at positions 1 and 2 are specified as stearoyl and arachidonoyl respectively.
It is functionally related to an arachidonic acid and an octadecanoic acid.
Create a molecule with the structure as the one described: The molecule is a primary arylamine in which an amino functional group is substituted for one of the benzene hydrogens. It is a primary arylamine and a member of anilines.
[N][C][=C][C][=C][C][=C][Ring1][=Branch1]
With the provided reactants and reagents, propose a potential product: [O][=N+1][Branch1][C][O-1][C][=C][N][=C][Branch1][C][Cl][C][Branch1][C][I][=C][Ring1][Branch2].[Fe]
[N][C][=C][N][=C][Branch1][C][Cl][C][Branch1][C][I][=C][Ring1][Branch2]
Please suggest potential reactants used in the synthesis of the provided product: [C][=C][C][C][N][C][=Branch1][C][=O][O][C][Branch1][C][C][Branch1][C][C][C]
[C][=C][C][C][N].[C][C][Branch1][C][C][Branch1][C][C][O][C][=Branch1][C][=O][O][C][=Branch1][C][=O][O][C][Branch1][C][C][Branch1][C][C][C]
Please provide possible reagents based on the following chemical reaction: [C][C][=C][C][=C][Branch1][C][N][C][=N][Ring1][#Branch1].[O][=C][Branch1][C][Cl][C][Cl]>>[C][C][=C][C][=C][Branch1][Branch2][N][C][=Branch1][C][=O][C][Cl][C][=N][Ring1][O]
[C][C][C][O][C][Ring1][Branch1].[C][C][N][Branch1][Ring1][C][C][C][C].[O]
Please provide the HOMO energy value for this molecule: [C][C][O][C][C][Branch1][C][C][C][Branch1][C][C][C]
-0.2482
MSNELVLSREQVRRVDQRAIEAYGVPGIVLMENAGRGAAEIIRAACPSAQRVLIACGPGNNGGDGFVIARHLANAGWMVELLLACPADRITGDAQGNHEIIRRMNLPCAVMADARDLEAANDRFATADVIVDALLGTGASGPPREPIASLIRAINEAHRRVSAQPAPSVFAVDIPSGLDCDTGEAANPTVRADHTITFVARKIGFRNPAARDLLGRVHVVDIGAPRAAIQDALTGKSG
Please evaluate the following protein sequence and provide an explanation of the enzyme's catalytic activity, including the chemical reaction it facilitates: MDKVAVAGFLPEELCASLSLSPSFRGNQIFQWIGKGVDSFDAMTNLSAELRASLAEKAILRSTRVSDVLKADDGTVKLQIQTEDDLAVETVLLTDKAARKTACVSCQAGCAMGCAFCKTGTLGLARNLSAAEIVEQFLYLEKHAGALDNIVFMGMGEPLLNLDALRKAIAVLTDKRGRNLSSRRITVSTVGIVSGIYDLANNGPDVRLAVSLTTADETLRRELMPASLTNPLSDLRQAISYYIEKTGKRVTLEAVLLSGKNTSEKNADSLIAFAKGLDVHVNLIPWNPVEGLSFVTPDPEETAQFVSRLEKGGLNVTLRMHRGKSISGACGQLGKTNPYA
Based on the provided protein sequence, the enzyme appears to facilitate the chemical reaction: adenosine(37) in tRNA + 2 reduced [2Fe-2S]-[ferredoxin] + 2 S- adenosyl-L-methionine = 2-methyladenosine(37) in tRNA + 5'- deoxyadenosine + L-methionine + 2 oxidized [2Fe-2S]-[ferredoxin] + S- adenosyl-L-homocysteine.
Analyze the following amino acid sequence, and determine the function of the resulting protein, its subcellular localization, and any biological processes it may be part of: MNGTVNASAPSKMSEVAVERLSNDKALKVIFVLGGPGSGKGTQCAKIAKHFGFTHLSVGDLLRAEINSGSKNGTMIESMINEGKIVRSEVTIKLLQRAMHESGNDKFLIDGFPRNEENRAAFENLEKIEPEFVLFFDCPMEEMERRILNRNQGRDDDKMETIRKRFKVFIESTLPVIEFYNLKGKLYKIDACKPADEVFEDVKAIFSRFRAKEDSSQQTNICTAKRFELVMCLIKRLFREIKRMWSSFFCKAL
The protein characterized by the amino acid sequence demonstrates ATP binding, cytidylate kinase activity, uridylate kinase activity and is implicated in the 'de novo' pyrimidine nucleobase biosynthetic process, phosphorylation, pyrimidine nucleotide biosynthetic process. Its subcellular localization is primarily within the cytoplasm, nucleus.
Examine the given protein sequence and share a brief overview of its attributes: MKIVLASNNQGKLAELKAMLAPLGVQLLRQAELGIPEAAEPFRTFVENALAKARHASALSGLPALADDAGLCVEAFGGLPGVDTAFYAVQFGYAKGDANNVKALLAQMAGITDRRAALVSTLVAVRSAEDPEPLIACGRVAGEVALEPMGSNGFGFDPVMFIPEFGQTFAQLPVEVKNANSHRGKATRQMMALMRERWIT
A concise description of the protein with the specified amino acid sequence includes: Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.
Given this protein sequence, can you identify any common protein motifs or domains that it may contain? MANTKYIFITGGVVSSLGKGIAAASIGALLESRGLSVSLIKVDPYINVDPGTMSPFQHGEVFVTEDGTETDLDLGHYERFVRFKASKKNNFTAGKVYETVIRNERKGNYLGGTVQVIPHITNEIKKRIKKGGQNKDIAIVEVGGTVGDIESQPFVEALRQMALELPNSSWAFVHLTLVPFINASGELKTKPTQHSVKELRSLGISPDVLVCRSEQELPKDEKNKIALFCSVPAKSVISMHDVDTVYSIPILLNKQKVDDTILKKLNLKIKKPNLNDWKRVVKAKLLPEKEVNVSFVGKYTELKDSYKSINEALEHAGIQNKAKVNINFVEAEQITSQNVRKVLKKSDAILVPGGFGERGIEGMILACKYARENNVPYLGICLGMQIAIIEYARNVLKLKSANSTEFDSSTKFPVIGLITEWSDISGKKEKRTKNSDLGGTMRLGGQVCKLKKKSNSYKMYKKSEIIERHRHRYEVNPNYKDKMIEQGLDVVGTSIDGKLVEMIELPSHKWFLACQFHPEFTSNPRDGHPIFNSYIKSTITK
Our predictive analysis of the given protein sequence reveals possible domains or motifs. These include: Glutamine amidotransferase, CTP synthase N-terminal domains.
Find and list all the instances of the chemical entities in the following content: "Both the control and caramiphen groups with double cannulas had significantly shorter latencies to seizure onset than the corresponding groups with single cannula."
caramiphen
You are provided with a set of clinical trial summaries. Extract the chemical-disease relations from the summaries and present your findings in the format of (Subject, Object): "Eating disorders and the associated behavioural problems and drug abuse are uncommon in pregnancy. When they do occur they are often unrecognized because of denial but when significant may pose a risk to both the mother and her fetus. This case illustrates a number of problems that may be encountered in women with eating disorders in pregnancy, including prolonged and recurrent metabolic disturbances and diuretic abuse. In particular it illustrates the derangements of thyroid function seen in pregnant women with eating disorders and reminds us that when a cause for thyrotoxicosis remains obscure, thyroxine abuse should be considered and explored."
(thyroxine, thyrotoxicosis)
Your task is to extract the subject and object entities from the provided text and establish the corresponding relation triples. Please format your answers as (Subject, Relation, Object): "Opioid receptors are the membrane proteins that mediate the pain-relieving effect of opioid drugs, such as morphine and fentanyl as well as endogenous opioid peptides enkephalins and endorphins. Using cDNAs for the mu and the kappa opioid receptors, we mapped the chromosomal locations of their genes in mouse. Multilocus cross analysis located the mu receptor gene Oprm on Chr 10 and the kappa receptor gene Oprk1 on Chr 1. Both genes are near centromere, with no markers more centromeric. These data indicate that the two opioid receptors are different gene products, ruling out the possibility that they may be differential splicing products from the same gene."
(morphine, regulator, Opioid receptors), (fentanyl, regulator, Opioid receptors)
Which of the following conditions does not show multifactorial inheritance? What of the following is the right choice? (A) Pyloric stenosis (B) Schizophrenia (C) Spina bifida (neural tube defects) (D) Marfan syndrome
The final answer is (D).
Does feeding tube insertion and its timing improve survival?
No, neither insertion of PEG tubes nor timing of insertion affect survival.
What virus causes chronic disease?
Hepatitis C virus (HCV).

We release the model weights on Hugging Face at:
We have provided a web version demo based on Gradio. To use it, you first need to download this repository:
>> git clone https://github.com/zjunlp/Mol-Instruction
>> cd demo
Step 1, install Gradio by running:pip install gradio.
Step 2, specify the parameters in the generate.sh file.
>> CUDA_VISIBLE_DEVICES=0 python generate.py \
--CLI False\
--protein False\
--load_8bit \
--base_model $BASE_MODEL_PATH \
--share_gradio True\
--lora_weights $FINETUNED_MODEL_PATH \
For models fine-tuned on molecule-oriented and biomolecular text instructions, please set $FINETUNED_MODEL_PATH to 'zjunlp/llama-molinst-molecule-7b' or 'zjunlp/llama-molinst-biotext-7b'.
For the model fine-tuned on protein-oriented instructions, you need to perform additional steps as described in this folder.
Step 3, run the generate.sh file in the repository:
>> sh generate.sh
We offer two methods: the first one is command-line interaction, and the second one is web-based interaction, which provides greater flexibility.
>> python generate.py
The program will run a web server and output an address. Open the output address in a browser to use it.
>> python generate.py --CLI True
The disadvantage is the inability to dynamically change decoding parameters.
To investigate whether Mol-Instructions can enhance LLM’s understanding of biomolecules, we conduct the following quantitative experiments. For detailed experimental settings and analysis, please refer to our paper. Please refer to the evaluation code to conduct the same experiments.
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.004 | 51.088 | 0.006 | 0.029 | 0.000 | 0.002 |
| Baize | 0.000 | 0.006 | 53.796 | 0.000 | 0.000 | 0.000 | 0.002 |
| ChatGLM | 0.000 | 0.004 | 53.157 | 0.005 | 0.000 | 0.000 | 0.005 |
| LLaMa | 0.000 | 0.003 | 59.864 | 0.005 | 0.000 | 0.000 | 0.003 |
| Vicuna | 0.000 | 0.006 | 60.356 | 0.006 | 0.001 | 0.000 | 0.001 |
| Galactica | 0.000 | 0.192 | 44.152 | 0.135 | 0.238 | 0.088 | 0.992 |
| Text+Chem T5 | 0.097 | 0.508 | 41.819 | 0.352 | 0.474 | 0.353 | 0.721 |
| MolT5 | 0.112 | 0.546 | 38.276 | 0.400 | 0.538 | 0.295 | 0.773 |
| Ours (LLaMA2-chat) | 0.002 | 0.345 | 41.367 | 0.231 | 0.412 | 0.147 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.025 | 0.521 | 38.742 | 0.358 | 0.520 | 0.221 | 1.000 |
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.065 | 41.989 | 0.004 | 0.024 | 0.008 | 0.138 |
| Baize | 0.000 | 0.044 | 41.500 | 0.004 | 0.025 | 0.009 | 0.097 |
| ChatGLM | 0.000 | 0.183 | 40.008 | 0.050 | 0.100 | 0.044 | 0.108 |
| LLaMa | 0.000 | 0.020 | 42.002 | 0.001 | 0.002 | 0.001 | 0.039 |
| Vicuna | 0.000 | 0.057 | 41.690 | 0.007 | 0.016 | 0.006 | 0.059 |
| Galactica | 0.000 | 0.468 | 35.021 | 0.156 | 0.257 | 0.097 | 0.946 |
| Text+Chem T5 | 0.239 | 0.782 | 20.413 | 0.705 | 0.789 | 0.652 | 0.762 |
| Ours (LLaMA2-chat) | 0.045 | 0.654 | 27.262 | 0.313 | 0.509 | 0.262 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.503 | 0.883 | 13.410 | 0.756 | 0.863 | 0.708 | 1.000 |
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.063 | 46.915 | 0.005 | 0.023 | 0.007 | 0.160 |
| Baize | 0.000 | 0.095 | 44.714 | 0.025 | 0.050 | 0.023 | 0.112 |
| ChatGLM | 0.000 | 0.117 | 48.365 | 0.056 | 0.075 | 0.043 | 0.046 |
| LLama | 0.000 | 0.036 | 46.844 | 0.018 | 0.029 | 0.017 | 0.010 |
| Vicuna | 0.000 | 0.057 | 46.877 | 0.025 | 0.030 | 0.021 | 0.017 |
| Galactica | 0.000 | 0.452 | 34.940 | 0.167 | 0.274 | 0.134 | 0.984 |
| Text+Chem T5 | 0.141 | 0.765 | 24.043 | 0.685 | 0.765 | 0.585 | 0.698 |
| Ours (LLaMA2-chat) | 0.009 | 0.705 | 31.227 | 0.283 | 0.487 | 0.230 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.333 | 0.842 | 17.642 | 0.704 | 0.815 | 0.646 | 1.000 |
| Metric | Exact↑ | BLEU↑ | Levenshtein↓ | RDK FTS↑ | MACC FTS↑ | Morgan FTS↑ | Validity↑ |
|---|---|---|---|---|---|---|---|
| Alpaca | 0.000 | 0.026 | 29.037 | 0.029 | 0.016 | 0.001 | 0.186 |
| Baize | 0.000 | 0.051 | 30.628 | 0.022 | 0.018 | 0.004 | 0.099 |
| ChatGLM | 0.000 | 0.019 | 29.169 | 0.017 | 0.006 | 0.002 | 0.074 |
| LLaMa | 0.000 | 0.003 | 28.040 | 0.037 | 0.001 | 0.001 | 0.001 |
| Vicuna | 0.000 | 0.010 | 27.948 | 0.038 | 0.002 | 0.001 | 0.007 |
| Galactica | 0.000 | 0.141 | 30.760 | 0.036 | 0.127 | 0.051 | 0.995 |
| Text+Chem T5 | 0.000 | 0.225 | 49.323 | 0.039 | 0.186 | 0.052 | 0.313 |
| Ours (LLaMA2-chat) | 0.044 | 0.224 | 23.167 | 0.237 | 0.364 | 0.213 | 1.000 |
| Ours (LLaMA3-Instruct) | 0.101 | 0.648 | 18.326 | 0.412 | 0.521 | 0.375 | 1.000 |
| Metric | MAE↓ |
|---|---|
| Alpaca | 322.109 |
| Baize | 261.343 |
| ChatGLM | - |
| LLaMa | 5.553 |
| Vicuna | 860.051 |
| Galactica | 0.568 |
| Ours (LLaMA2-chat) | 0.013 |
| Ours (LLaMA3-Instruct) | 15.059 |
| Metric | BLEU-2↑ | BLEU-4↑ | ROUGE-1↑ | ROUGE-2↑ | ROUGE-L↑ | METEOR↑ |
|---|---|---|---|---|---|---|
| Alpaca | 0.068 | 0.014 | 0.178 | 0.041 | 0.136 | 0.107 |
| Baize | 0.064 | 0.015 | 0.189 | 0.053 | 0.148 | 0.106 |
| ChatGLM | 0.055 | 0.011 | 0.163 | 0.036 | 0.121 | 0.105 |
| LLaMa | 0.059 | 0.014 | 0.164 | 0.066 | 0.148 | 0.184 |
| Vicuna | 0.052 | 0.011 | 0.151 | 0.055 | 0.130 | 0.168 |
| Galactica | 0.024 | 0.008 | 0.074 | 0.015 | 0.063 | 0.065 |
| Text+Chem T5 | 0.062 | 0.036 | 0.126 | 0.075 | 0.119 | 0.139 |
| MolT5 | 0.002 | 0.001 | 0.036 | 0.001 | 0.034 | 0.033 |
| Ours (LLaMA2-chat) | 0.217 | 0.143 | 0.337 | 0.196 | 0.291 | 0.254 |
| Ours (LLaMA3-Instruct) | 0.419 | 0.361 | 0.719 | 0.646 | 0.709 | 0.637 |
| Task | Protein Function | Functional Description | Catalytic Activity | Domain/Motif |
|---|---|---|---|---|
| Metric | ROUGE-L↑ | ROUGE-L↑ | ROUGE-L↑ | ROUGE-L↑ |
| Alpaca | 0.20 | 0.10 | 0.23 | 0.12 |
| Baize | 0.20 | 0.15 | 0.22 | 0.13 |
| ChatGLM | 0.15 | 0.14 | 0.13 | 0.10 |
| LLaMa | 0.12 | 0.12 | 0.13 | 0.09 |
| Vicuna | 0.15 | 0.14 | 0.16 | 0.12 |
| Galactica | 0.07 | 0.08 | 0.08 | 0.06 |
| Ours (LLaMA) | 0.43 | 0.44 | 0.52 | 0.46 |
| Task | True or False | Multi-choice | Chemical Entity Recognition | Chemical-disease Interaction Extraction | Chemical-protein Interaction Extraction |
|---|---|---|---|---|---|
| Metric | Acc↑ | Acc↑ | F1↑ | F1↑ | F1↑ |
| Alpaca | 0.330 | 0.286 | 0.213 | 0.037 | 0.002 |
| Baize | 0.480 | 0.237 | 0.009 | 0.004 | 0.004 |
| ChatGLM | 0.180 | 0.223 | 0.150 | 0.020 | 0.003 |
| LLaMa | 0.270 | 0.297 | 0.000 | 0.050 | 0.003 |
| Vicuna | 0.120 | 0.290 | 0.024 | 0.084 | 0.013 |
| Galactica | 0.420 | 0.312 | 0.166 | 0.026 | 0.001 |
| PMC_LLaMa | 0.510 | 0.625 | 0.003 | 0.000 | 0.000 |
| Ours (LLaMA2-chat) | 0.550 | 0.649 | 0.753 | 0.399 | 0.224 |
| Ours (LLaMA3-instruct) | 0.600 | 0.961 | 0.694 | 0.355 | 0.177 |
| Task | BLEU↑ | ROUGE-1↑ | BertScore↑ |
|---|---|---|---|
| Alpaca | 0.003 | 0.088 | 0.824 |
| Baize | 0.005 | 0.100 | 0.811 |
| ChatGLM | 0.003 | 0.090 | 0.795 |
| LLaMa | 0.003 | 0.100 | 0.814 |
| Vicuna | 0.004 | 0.097 | 0.814 |
| Galactica | 0.000 | 0.039 | 0.794 |
| PMC_LLaMA | 0.007 | 0.788 | 0.625 |
| Ours (LLaMA2-chat) | 0.024 | 0.221 | 0.837 |
| Ours (LLaMA3-instruct) | 0.010 | 0.198 | 0.846 |
Question: What action should be taken if the model encounters <unk> and subsequently repeats the input during decoding?
Answer: Consider reducing the value of the max tokens.
Question: What should I do if the model encounters � during decoding?
Answer: If this symbol emerges in the middle of the decoded sentence, we recommend changing the input. If it shows up at the end of the sentence, you can tackle this issue by extending the output length.
Question: Why do I receive varied results despite using identical decoding parameters?
Answer: This might occur if you have enabled do_sample=True. Another factor could be the order in which tasks are executed. A useful approach would be to use a for loop to generate multiple outputs with the same decoding parameters, enabling you to note the variance in each output.
Question: What could be the reason for subpar answer quality?
Answer: Modifying the decoding parameters could help in improving the quality of the extraction or the answer.
Please note that all data and model weights of Mol-Instructions is exclusively licensed for research purposes. The accompanying dataset is licensed under CC BY 4.0.
We emphatically urge all users to adhere to the highest ethical standards when using our dataset, including maintaining fairness, transparency, and responsibility in their research. Any usage of the dataset that may lead to harm or pose a detriment to society is strictly forbidden.
In terms of dataset maintenance, we pledge our commitment to provide necessary upkeep. This will ensure the continued relevance and usability of the dataset in light of evolving research landscapes. This commitment encompasses regular updates, error checks, and amendments in accordance with field advancements and user feedback.
The current state of the model, obtained via instruction tuning, is a preliminary demonstration. Its capacity to handle real-world, production-grade tasks remains limited. Moreover, there is a vast reservoir of rich instruction data that remains to be collected and exploited.
@inproceedings{fang2023mol,
author = {Yin Fang and
Xiaozhuan Liang and
Ningyu Zhang and
Kangwei Liu and
Rui Huang and
Zhuo Chen and
Xiaohui Fan and
Huajun Chen},
title = {Mol-Instructions: {A} Large-Scale Biomolecular Instruction Dataset
for Large Language Models},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/pdf?id=Tlsdsb6l9n}
}
We appreciate LLaMA, Huggingface Transformers Llama, Alpaca, Alpaca-LoRA, Chatbot Service and many other related works for their open-source contributions. The logo of the model is automatically generated by Wenxin Yige.
Python
100.0%